people crowd audience army men women — free black and white photo

Home  /  People  /  people crowd audience army men women

people crowd audience army men women

Public-domain black & white photograph.

protestvietnamwarmilitaryagainstpolicesignsarmydemonstrationgunscrowd 1967protestersoppositionpentagonaudience eventuniformssoldierssit

Similar black & white photos

person creative black and white people — black and white photo
person creative black and white people
people atmosphere audience music festival — black and white photo
people atmosphere audience music festival
silhouette music people smoke crowd — black and white photo
silhouette music people smoke crowd
music group people audience dance — black and white photo
music group people audience dance
people crowd audience plaza festival — black and white photo
people crowd audience plaza festival
adult battle bihar bihari festival — black and white photo
adult battle bihar bihari festival
music light people crowd audience rave — black and white photo
music light people crowd audience rave
people crowd celebration audience — black and white photo
people crowd celebration audience
people crowd audience carnival festival — black and white photo
people crowd audience carnival festival
person black and white people girl boy — black and white photo
person black and white people girl boy
person people crowd audience education — black and white photo
person people crowd audience education